PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr9P18360_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 283aa    MW: 31984.3 Da    PI: 4.5173
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr9P18360_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.62.8e-2069123357
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                            k++++t eq++ Le+ Fe+++++  e++ eLA+klgL+ rqV vWFqNrRa++k+
  GSMUA_Achr9P18360_001  69 KKRRLTLEQIHLLERSFEEDNKLEPERKSELARKLGLQPRQVAVWFQNRRARWKN 123
                            56689************************************************95 PP

2HD-ZIP_I/II128.72.3e-4168160193
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            ekkrrl+ eq++lLE+sFee++kLeperK+elar+LglqprqvavWFqnrRAR+k+kqlE+++++L+++ydal +++++L k++++Lr
  GSMUA_Achr9P18360_001  68 EKKRRLTLEQIHLLERSFEEDNKLEPERKSELARKLGLQPRQVAVWFQNRRARWKNKQLEREFDQLRSSYDALLANHDALLKDNDRLR 155
                            69************************************************************************************** PP

            HD-ZIP_I/II  89 eelke 93 
                            +++++
  GSMUA_Achr9P18360_001 156 SQVNS 160
                            *9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.72E-2062126IPR009057Homeodomain-like
PROSITE profilePS5007118.15564124IPR001356Homeobox domain
SMARTSM003892.3E-2067128IPR001356Homeobox domain
PfamPF000461.5E-1769123IPR001356Homeobox domain
CDDcd000863.58E-1969125No hitNo description
Gene3DG3DSA:1.10.10.609.6E-2174124IPR009057Homeodomain-like
PRINTSPR000311.2E-695104IPR000047Helix-turn-helix motif
PROSITE patternPS00027099122IPR017970Homeobox, conserved site
PRINTSPR000311.2E-6104120IPR000047Helix-turn-helix motif
PfamPF021832.9E-15124166IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MGSSCLIFDS SSSSSSRGRL LVLGGGSPIF QGTTSLAAIL DGGASKRRPF FTSPDEIYEE  60
YYEEQLPEKK RRLTLEQIHL LERSFEEDNK LEPERKSELA RKLGLQPRQV AVWFQNRRAR  120
WKNKQLEREF DQLRSSYDAL LANHDALLKD NDRLRSQVNS LIEQLQAKEQ GASEVTGVVQ  180
HEQAASSADL MAPNIQQTVE LSTGSGGSTV VVEAEGTNHP EESSRQSYLP ETYHGVGLVA  240
CGIRTEDDDL SDEGCSYYPD AMFMELQHQE EEAHLPWWEW DQM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116124RRARWKNKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFM8787430.0FM878743.1 Musa acuminata subsp. burmannicoides var. calcutta 4 mRNA containing microsatellite, clone MAC4-54L20-F.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009418017.10.0PREDICTED: homeobox-leucine zipper protein HOX16-like
SwissprotQ6YWR43e-70HOX16_ORYSJ; Homeobox-leucine zipper protein HOX16
TrEMBLM0U1E30.0M0U1E3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P18360_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26093887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.14e-64homeobox 1